PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10001816m
Common NameCARUB_v10001433mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 247aa    MW: 28606.9 Da    PI: 10.4935
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10001816mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.41.6e-184592148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+ +++++G g+W++ +++ g++R++k+c++rw +yl
  Carubv10001816m 45 KGPWTPEEDQKLLAYIEEHGHGSWRSLPEKAGLHRCGKSCRLRWTNYL 92
                     79********************************************97 PP

2Myb_DNA-binding51.52.4e-1698143148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++  +E++ +++++++lG++ W++Ia +++ +Rt++++k++w+++l
  Carubv10001816m  98 RGKFNLQEEQTIIQLHALLGNR-WSAIATHLP-KRTDNEIKNYWNTHL 143
                      899*******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.4E-263694IPR009057Homeodomain-like
PROSITE profilePS5129418.7054092IPR017930Myb domain
SuperFamilySSF466896.36E-3142139IPR009057Homeodomain-like
SMARTSM007177.2E-164494IPR001005SANT/Myb domain
PfamPF002493.7E-174592IPR001005SANT/Myb domain
CDDcd001673.27E-114792No hitNo description
PROSITE profilePS5129425.2593147IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.2E-2695148IPR009057Homeodomain-like
SMARTSM007173.9E-1697145IPR001005SANT/Myb domain
PfamPF002491.6E-1598143IPR001005SANT/Myb domain
CDDcd001672.47E-10100143No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000902Biological Processcell morphogenesis
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MYETLQLTFL HIFLFCSVIR LVYYSLAFGR KMGRSPCCDK LGLKKGPWTP EEDQKLLAYI  60
EEHGHGSWRS LPEKAGLHRC GKSCRLRWTN YLRPDIKRGK FNLQEEQTII QLHALLGNRW  120
SAIATHLPKR TDNEIKNYWN THLKKRLVKM GIDPVTHKPK NETPLSSLGL SKNAAILSHT  180
AQWESARLEA EARLARESKL LHLQHYQTKA SSHHHHHHHG FTHKSLLTNW TTKTNEGKQK  240
KNTHTH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-26431475108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2284740.0AK228474.1 Arabidopsis thaliana mRNA for myb-related protein - like, complete cds, clone: RAFL15-07-O19.
GenBankX998090.0X99809.1 A.thaliana mRNA for Mixta protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006288195.10.0hypothetical protein CARUB_v10001433mg
SwissprotQ8GWP02e-71MYB39_ARATH; Transcription factor MYB39
TrEMBLR0HBP00.0R0HBP0_9BRAS; Uncharacterized protein
STRINGAT5G15310.11e-143(Arabidopsis thaliana)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15310.11e-127myb domain protein 16